Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026825
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BBR-BPC
Protein Properties Length: 288aa    MW: 32204.8 Da    PI: 10.3992
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026825genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
    GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki...rernlalsekkaavaerdmaflqrdkalae.rnkalverdnkllalllvenslasa 94 
                  m+d g ++rn+ +ye++ +   nl+l+l+ s + r + +   re+ + + ++ + + +    f   ++ l+    k  v rd+ + +++ ++      
                  99999999*********88889**********88888878766666644444444433....4.22333333124445555554444444333..... PP

    GAGA_bind  95 lpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekk 192
                  + +g++  + ++s+++lqq    ql++++++ +e  k     + +   ++++ + +kkrq+ + pk +kakk+k+ ++ +k++ ++++  +r+ka +k
                  3567888899999998888....77777666.3333333344444.44455556677799***************7766666666665..79****** PP

    GAGA_bind 193 sidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWA 290
                  ++d+v+ng+++D s++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmSqgafkk+LekLa+e ++++ ++DL+ hWA
                  ************************************************************************************************** PP

    GAGA_bind 291 kHGtnkfvtir 301
  DCAR_026825 277 RHGTNKFVTIR 287
                  **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012268.7E-1161287IPR010409GAGA-binding transcriptional activator
PfamPF062171.4E-942287IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001268137.11e-105GAGA-binding transcriptional activator BBR/BPC1-like
RefseqXP_010650443.11e-105PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
RefseqXP_010650043.11e-105PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
RefseqXP_010649609.11e-105PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
TrEMBLB2Z4541e-105B2Z454_VITVI; GAGA-binding transcriptional activator BBR/BPC1-like
TrEMBLF6HFA41e-104F6HFA4_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g06380.t011e-104(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.22e-74basic pentacysteine1